Name | FAM83E, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5300024 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | FAM83E antibody was raised using the middle region of FAM83E corresponding to a region with amino acids RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM |
Purity/Format | Affinity purified |
Description | FAM83E antibody |
Gene | FAM83E |
Supplier Page | Shop |