FAM92B, Polyclonal Antibody

Name FAM92B, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300140
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH
Purity/Format Affinity purified
Description FAM92B antibody
Gene FAM92B
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.