Name | FAM92B, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5300140 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat |
Antigen | FAM92B antibody was raised using the N terminal of FAM92B corresponding to a region with amino acids FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH |
Purity/Format | Affinity purified |
Description | FAM92B antibody |
Gene | FAM92B |
Supplier Page | Shop |