| Name | FHOD3, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303475 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | FHOD3 antibody was raised using the C terminal of FHOD3 corresponding to a region with amino acids SGKFSGSSPAPPSQPQGLSYAEDAAEHENMKAVLKTSSPSVEDATPALGV |
| Purity/Format | Affinity purified |
| Description | FHOD3 antibody |
| Gene | FMNL3 |
| Supplier Page | Shop |