| Name | FLJ20674, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300237 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | FLJ20674 antibody was raised using the N terminal of FLJ20674 corresponding to a region with amino acids LNVTQWFQVWLQVASGPYQIEVHIVATGTLPNGTLYAARGSQVDFSCNSS |
| Purity/Format | Affinity purified |
| Description | FLJ20674 antibody |
| Gene | VSIG10 |
| Supplier Page | Shop |