| Name | FLJ22167, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839745 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human, Dog |
| Antigen | FLJ22167 antibody was raised using the N terminal of FLJ22167 corresponding to a region with amino acids CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA |
| Purity/Format | Total IgG Protein A purified |
| Description | FLJ22167 antibody |
| Gene | TMEM231 |
| Supplier Page | Shop |