| Name | FLJ37543, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301178 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | FLJ37543 antibody was raised using the N terminal of FLJ37543 corresponding to a region with amino acids MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGP |
| Purity/Format | Affinity purified |
| Description | FLJ37543 antibody |
| Gene | C5orf64 |
| Supplier Page | Shop |