| Name | GALNTL4, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839634 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | GALNTL4 antibody was raised using the middle region of GALNTL4 corresponding to a region with amino acids IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV |
| Purity/Format | Affinity purified |
| Description | GALNTL4 antibody |
| Gene | GALNT18 |
| Supplier Page | Shop |