| Name | HS6ST3, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303066 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | HS6ST3 antibody was raised using the C terminal of HS6ST3 corresponding to a region with amino acids TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW |
| Purity/Format | Affinity purified |
| Description | HS6ST3 antibody |
| Gene | HS6ST3 |
| Supplier Page | Shop |