| Name | KAP11.1, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301698 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KAP11.1 antibody was raised using the N terminal of KRTAP11-1 corresponding to a region with amino acids SFNCSTRNCSSRPIGGRCIVPVAQVTTTSTTDADCLGGICLPSSFQTGSW |
| Purity/Format | Affinity purified |
| Description | KAP11.1 antibody |
| Gene | KRTAP11-1 |
| Supplier Page | Shop |