| Name | KAP24.1, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300200 |
| Prices | $490.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KAP24.1 antibody was raised using the middle region of KRTAP24-1 corresponding to a region with amino acids LVRNYHYSSYRPTSCRPLSYLSRSFRSLSYIPSTFPPLRYLCSGSRPLKC |
| Purity/Format | Affinity purified |
| Description | KAP24.1 antibody |
| Gene | KRTAP24-1 |
| Supplier Page | Shop |