| Name | KIAA0515, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302144 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | KIAA0515 antibody was raised using the N terminal of KIAA0515 corresponding to a region with amino acids ATASQPPESLPQPGLQKSVSNLQKPTQSISQENTNSVPGGPKSWAQLNGK |
| Purity/Format | Affinity purified |
| Description | KIAA0515 antibody |
| Gene | PRRC2B |
| Supplier Page | Shop |