KIAA1024, Polyclonal Antibody

Name KIAA1024, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300261
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen KIAA1024 antibody was raised using the C terminal of KIAA1024 corresponding to a region with amino acids DNKDWHRKSKEADRQYDIPPQHRLPKQPKDGFLVEQVFSPHPYPASLKAH
Purity/Format Affinity purified
Description KIAA1024 antibody
Gene KIAA1024
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.