| Name | KIAA1704, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839208 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKG |
| Purity/Format | Affinity purified |
| Description | KIAA1704 antibody |
| Gene | GPALPP1 |
| Supplier Page | Shop |