| Name | KIF1A, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302008 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | KIF1A antibody was raised using the N terminal of KIF1A corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH |
| Purity/Format | Affinity purified |
| Description | KIF1A antibody |
| Gene | KIF1A |
| Supplier Page | Shop |