LIN37, Polyclonal Antibody

Name LIN37, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5301408
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LIN37 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQRRKKRREMDDGLAEGGPQRSNTYVIKLFDRSVDLAQFSENTPLYPICR
Purity/Format Affinity purified
Description LIN37 antibody
Gene LIN37
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.