| Name | LOC441956, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302013 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LOC441956 antibody was raised using the N terminal of LOC441956 corresponding to a region with amino acids APEDPASLRHGLWHQRTQPLAPWTMAAEDPAPRILDYGSRGPSLPASWTK |
| Purity/Format | Affinity purified |
| Description | LOC441956 antibody |
| Gene | LOC441956 |
| Supplier Page | Shop |