Name | LOC92270, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5303194 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | LOC92270 antibody was raised using the C terminal of LOC92270 corresponding to a region with amino acids LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS |
Purity/Format | Affinity purified |
Description | LOC92270 antibody |
Gene | ATP6AP1L |
Supplier Page | Shop |