| Name | LOC92270, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303194 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | LOC92270 antibody was raised using the C terminal of LOC92270 corresponding to a region with amino acids LHMLIYLRYLDQQYDLIASPAHFSQLKARDTAEEKELLRSQGAECYKLRS |
| Purity/Format | Affinity purified |
| Description | LOC92270 antibody |
| Gene | ATP6AP1L |
| Supplier Page | Shop |