LRRC17, Polyclonal Antibody

Name LRRC17, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839697
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LRRC17 antibody was raised using the middle region of LRRC17 corresponding to a region with amino acids YVFPIQTLDCKRKELKKVPNNIPPDIVKLDLSYNKINQLRPKEFEDVHEL
Purity/Format Affinity purified
Description LRRC17 antibody
Gene LRRC17
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.