LRRC49, Polyclonal Antibody

Name LRRC49, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5301424
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat
Antigen LRRC49 antibody was raised using the N terminal of LRRC49 corresponding to a region with amino acids KVEFKLNKDTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRS
Purity/Format Affinity purified
Description LRRC49 antibody
Gene LRRC49
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.