| Name | LRRC56, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301258 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | LRRC56 antibody was raised using the N terminal of LRRC56 corresponding to a region with amino acids LEMCVDTREGSLGNFGVHLPNLDQLKLNGSHLGSLRDLGTSLGHLQVLWL |
| Purity/Format | Affinity purified |
| Description | LRRC56 antibody |
| Gene | LRRC56 |
| Supplier Page | Shop |