LRRC66, Polyclonal Antibody

Name LRRC66, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303352
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LRRC66 antibody was raised using the middle region of LRRC66 corresponding to a region with amino acids NVTFQTIPGKCKNQEDPFEKPLISAPDSGMYKTHLENASDTDRSEGLSPW
Purity/Format Affinity purified
Description LRRC66 antibody
Gene LRRC66
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.