LST-3TM12, Polyclonal Antibody

Name LST-3TM12, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5302919
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH
Purity/Format Affinity purified
Description LST-3TM12 antibody
Gene SLCO1B7
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.