Name | LST-3TM12, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS839600 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | LST-3TM12 antibody was raised using the middle region of LST-3TM12 corresponding to a region with amino acids RAFFGLKVALIFPVLVLLTVFIFVVRKKSHGKDTKVLENERQVMDEANLE |
Purity/Format | Affinity purified |
Description | LST-3TM12 antibody |
Gene | SLCO1B7 |
Supplier Page | Shop |