Name | LYSMD2, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5302530 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse |
Antigen | LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE |
Purity/Format | Affinity purified |
Description | LYSMD2 antibody |
Gene | LYSMD2 |
Supplier Page | Shop |