LYSMD2, Polyclonal Antibody

Name LYSMD2, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5302530
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse
Antigen LYSMD2 antibody was raised using the middle region of LYSMD2 corresponding to a region with amino acids VEHRVRAGDTLQGIALKYGVTMEQIKRANKLFTNDCIFLKKTLNIPVISE
Purity/Format Affinity purified
Description LYSMD2 antibody
Gene LYSMD2
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.