| Name | MGC34821, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5303113 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MGC34821 antibody was raised using the middle region of Mgc34821 corresponding to a region with amino acids VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF |
| Purity/Format | Affinity purified |
| Description | MGC34821 antibody |
| Gene | SLC22A24 |
| Supplier Page | Shop |