| Name | MGC50273, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS838939 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | MGC50273 antibody was raised using the N terminal of MGC50273 corresponding to a region with amino acids MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE |
| Purity/Format | Affinity purified |
| Description | MGC50273 antibody |
| Gene | C2orf27B |
| Supplier Page | Shop |