NDUFC1, Polyclonal Antibody

Name NDUFC1, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5300452
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NDUFC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYKRRNGL
Purity/Format Affinity purified
Description NDUFC1 antibody
Gene NDUFC1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.