| Name | NECAP2, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839389 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | NECAP2 antibody was raised using the N terminal of NECAP2 corresponding to a region with amino acids WQLDQPSWSGRLRITAKGQMAYIKLEDRTSGELFAQAPVDQFPGTAVESV |
| Purity/Format | Affinity purified |
| Description | NECAP2 antibody |
| Gene | NECAP2 |
| Supplier Page | Shop |