| Name | NSUN5C, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301990 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | NSUN5C antibody was raised using the middle region of NSUN5C corresponding to a region with amino acids PALPARPHRGLSTFPGAEHCLRASPKTTLSGGFFVAVIERVEMPTSASQA |
| Purity/Format | Total IgG Protein A purified |
| Description | NSUN5C antibody |
| Gene | NSUN5P2 |
| Supplier Page | Shop |