| Name | NUDT16L1, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302873 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | NUDT16L1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GLVRVPLYTQKDRVGGFPNFLSNAFVSTAKCQLLFALKVLNMMPEEKLVE |
| Purity/Format | Total IgG Protein A purified |
| Description | NUDT16L1 antibody |
| Gene | NUDT16L1 |
| Supplier Page | Shop |