NUDT17, Polyclonal Antibody

Name NUDT17, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5301318
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen NUDT17 antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD
Purity/Format Affinity purified
Description NUDT17 antibody
Gene NUDT17
Supplier Page Shop