| Name | ODF3L1, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300944 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | ODF3L1 antibody was raised using the N terminal of ODF3L1 corresponding to a region with amino acids KLPKGTRSSVYFAQHPEKEPLPSRQEVKQTPVIMAKIKGPGPAKYLRPSC |
| Purity/Format | Affinity purified |
| Description | ODF3L1 antibody |
| Gene | ODF3L1 |
| Supplier Page | Shop |