| Name | OR6C75, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302973 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | OR6C75 antibody was raised using the middle region of OR6C75 corresponding to a region with amino acids SCIFMYIKTSARERVTLSKGVAVLNTSVAPLLNPFIYTLRNKQVKQAFKS |
| Purity/Format | Affinity purified |
| Description | OR6C75 antibody |
| Gene | OR6C75 |
| Supplier Page | Shop |