PABPC1L2A, Polyclonal Antibody

Name PABPC1L2A, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839488
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PABPC1L2A antibody was raised using a synthetic peptide corresponding to a region with amino acids NGMFLNYRKIFVGRFKSHKEREAERGAWARQSTSADVKDFEEDTDEEATL
Purity/Format Affinity purified
Description PABPC1L2A antibody
Gene PABPC1L2A
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.