PKDREJ, Polyclonal Antibody

Name PKDREJ, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303381
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen PKDREJ antibody was raised using the middle region of PKDREJ corresponding to a region with amino acids GVADNGSVLEITPDVAEVYLVRKNLTFAAFNLTVGPNSEVDGSLKKTTGG
Purity/Format Affinity purified
Description PKDREJ antibody
Gene PKDREJ
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.