| Name | PLAC1L, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302464 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PLAC1L antibody was raised using the middle region of PLAC1L corresponding to a region with amino acids YLVRDCGIRTRVVSEETLLFQTELYFTPRNIDHDPQEIHLECSTSRKSVW |
| Purity/Format | Affinity purified |
| Description | PLAC1L antibody |
| Gene | OOSP2 |
| Supplier Page | Shop |