| Name | PNPLA5, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300321 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | PNPLA5 antibody was raised using the C terminal of PNPLA5 corresponding to a region with amino acids NMALEVFSRTKAQLLGPISPPATRVLETSPLQPQIAPHREELGPTHQA |
| Purity/Format | Affinity purified |
| Description | PNPLA5 antibody |
| Gene | PNPLA5 |
| Supplier Page | Shop |