| Name | PP2447, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302265 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | PP2447 antibody was raised using the N terminal Of Pp2447 corresponding to a region with amino acids MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK |
| Purity/Format | Total IgG Protein A purified |
| Description | PP2447 antibody |
| Gene | TRABD |
| Supplier Page | Shop |