| Name | PWWP2A, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS839018 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Rat |
| Antigen | PWWP2A antibody was raised using the C terminal of PWWP2A corresponding to a region with amino acids PQSRCTSTRSAGLNKWQLLHQTVTSPAAPLQCLTDHCGFRLGALKLTVKR |
| Purity/Format | Affinity purified |
| Description | PWWP2A antibody |
| Gene | PWWP2A |
| Supplier Page | Shop |