| Name | RALGPS1, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302489 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RALGPS1 antibody was raised using the middle region of RALGPS1 corresponding to a region with amino acids AGSLPTPPVPRHRKSHSLGNNMMCQLSVVESKSATFPSEKARHLLDDSVL |
| Purity/Format | Affinity purified |
| Description | RALGPS1 antibody |
| Gene | RALGPS1 |
| Supplier Page | Shop |