| Name | RC3H2, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300084 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | RC3H2 antibody was raised using the middle region of RC3H2 corresponding to a region with amino acids YSRKGHETPQPQPNSKYKTSMCRDLRQQGGCPRGTNCTFAHSQEELEKYR |
| Purity/Format | Affinity purified |
| Description | RC3H2 antibody |
| Gene | RC3H2 |
| Supplier Page | Shop |