Name | RNF44, Polyclonal Antibody |
---|---|
Supplier | MyBioSource |
Catalog | MBS5302082 |
Prices | $455.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL |
Purity/Format | Affinity purified |
Description | RNF44 antibody |
Gene | RNF44 |
Supplier Page | Shop |