RNPEPL1, Polyclonal Antibody

Name RNPEPL1, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303351
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen RNPEPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYD
Purity/Format Affinity purified
Description RNPEPL1 antibody
Gene RNPEPL1
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.