| Name | RWDD2A, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300003 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse |
| Antigen | RWDD2A antibody was raised using the N terminal of RWDD2A corresponding to a region with amino acids NALTNIKRYLEGTREALPPKIEFVITLQIEEPKVKIDLQVTMPHSYPYVA |
| Purity/Format | Affinity purified |
| Description | RWDD2A antibody |
| Gene | RWDD2A |
| Supplier Page | Shop |