| Name | SARDH, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5301429 |
| Prices | $370.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human, Mouse, Rat, Dog, Zebrafish |
| Antigen | SARDH antibody was raised using the middle region of SARDH corresponding to a region with amino acids DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ |
| Purity/Format | Total IgG Protein A purified |
| Description | SARDH antibody |
| Gene | SARDH |
| Supplier Page | Shop |