SC5DL, Polyclonal Antibody

Name SC5DL, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5302923
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SC5DL antibody was raised using a synthetic peptide corresponding to a region with amino acids NQVRREIKFTVQALPWISILTVALFLLEIRGYSKLHDDLGEFPYGLFELV
Purity/Format Affinity purified
Description SC5DL antibody
Gene SC5D
Supplier Page Shop