SEC22C, Polyclonal Antibody

Name SEC22C, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS5303079
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SEC22C antibody was raised using a synthetic peptide corresponding to a region with amino acids FRMEPVTALGILSLILNIMCAALNLIRGVHLAEHSLQVAHEEIGNILAFL
Purity/Format Affinity purified
Description SEC22C antibody
Gene SEC22C
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.