SLC16A6, Polyclonal Antibody

Name SLC16A6, Polyclonal Antibody
Supplier MyBioSource
Catalog MBS839996
Prices $455.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen SLC16A6 antibody was raised using a synthetic peptide corresponding to a region with amino acids ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA
Purity/Format Affinity purified
Description SLC16A6 antibody
Gene SLC16A6
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.