| Name | SLC17A4, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5300894 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human, Mouse, Rat |
| Antigen | SLC17A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YFCEYWLFYTIMAYTPTYISSVLQANLRDSGILSALPFVVGCICIILGGL |
| Purity/Format | Affinity purified |
| Description | SLC17A4 antibody |
| Gene | SLC17A4 |
| Supplier Page | Shop |