| Name | SLC25A32, Polyclonal Antibody |
|---|---|
| Supplier | MyBioSource |
| Catalog | MBS5302357 |
| Prices | $455.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Dog |
| Antigen | SLC25A32 antibody was raised using the N terminal of SLC25A32 corresponding to a region with amino acids VRYENLIAGVSGGVLSNLALHPLDLVKIRFAVSDGLELRPKYNGILHCLT |
| Purity/Format | Affinity purified |
| Description | SLC25A32 antibody |
| Gene | SLC25A32 |
| Supplier Page | Shop |